PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010102554.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 426aa    MW: 48026.2 Da    PI: 6.9426
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010102554.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32240294155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWt++LHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt++h+kSHLQkYR+
  XP_010102554.1 240 KTRIRWTQDLHEKFVECVNRLGGAEKATPKAILKLMDSEGLTIYHIKSHLQKYRI 294
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.031237297IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-29238295IPR009057Homeodomain-like
SuperFamilySSF466898.96E-17238294IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23240295IPR006447Myb domain, plants
PfamPF002494.4E-9244293IPR001005SANT/Myb domain
PfamPF143791.1E-19325370IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MNDHKIACQG RNQVQQNHGL KITDRSFEFV PRSSHLFGVQ NHPENMGIWT RQQPCTMDNQ  60
ARLSQLQNLV SPVNNNNNNN NSDKSSSSTI MISCFESPAS AFYATERCMR FAEYDSQVCY  120
DNPSLNSHFS SGHQSSAENY SIDTNDQSEP NFEFRNSLQP MVKPHPSFGH DQRNKLHIDT  180
ATTASSIRRQ FSVPSKENQD LGLNFACHQE KQSPRFSSGN GCISTITLNT ASTGPGISSK  240
TRIRWTQDLH EKFVECVNRL GGAEKATPKA ILKLMDSEGL TIYHIKSHLQ KYRIAKYLPD  300
SSEGKSEKRA CINVTPQLEA TTGLQIKEAL QLQLDVQRRL HEQLEIQRNL QLQIEEQGRQ  360
LKMMFDKQQR KSNSLFKSQC SAITSPDLDH DHDDDYDDAP SNNGIDEVQV SIAEASGNTN  420
FPSKIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102554.10.0Myb family transcription factor APL
TrEMBLW9RIH60.0W9RIH6_9R
STRINGPOPTR_0006s20540.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.14e-79G2-like family protein